PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0004ss00990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 653aa    MW: 71495.2 Da    PI: 6.2827
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0004ss00990.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.34.6e-25295345152
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                        kpr++W+ eLH++Fv+av+qL G +kA+Pk+ilelm+v+gLt+e+v+SHLQ 
  Vang0004ss00990.1 295 KPRVVWSVELHQQFVSAVNQL-GLDKAVPKRILELMNVPGLTRENVASHLQG 345
                        79*******************.*****************************6 PP

2Response_reg57.57.6e-2013622125109
                        EEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
       Response_reg  25 evaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                        +++++++++ al+ll+e++  +D++l D+ mp+mdG++ll++   e  +lp+i++++ ++ + + + ++ Ga d+l Kp+ +eel++
  Vang0004ss00990.1 136 IITTCTEATVALNLLRERKgcFDVVLSDVHMPDMDGYKLLEHVGLEM-DLPVIMMSGDSTTSAVMKGIRHGACDYLIKPVREEELRN 221
                        7899**************9************************6644.8************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011025.0898227IPR001789Signal transduction response regulator, receiver domain
SMARTSM004481.6E-9123223IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.4E-16136222IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.23E-19137226No hitNo description
Gene3DG3DSA:3.40.50.23002.4E-29137242No hitNo description
SuperFamilySSF521726.55E-25137234IPR011006CheY-like superfamily
PROSITE profilePS512949.962292351IPR017930Myb domain
SuperFamilySSF466895.2E-16292348IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-25292344IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-21295345IPR006447Myb domain, plants
PfamPF002494.8E-7297347IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
MAQSRSAAGA CKGATAEFPA GLRSFGLDSP LVLTSQHLLR SIMIYGNYAK WFLMLTCGEA  60
YYFKYEIGGM IMDDIVSGFR DMPSLDLVRL IDCTYGEKEL LGRFFISSTR LTCKIGYFKG  120
GLYIYEWFNS CLTVAIITTC TEATVALNLL RERKGCFDVV LSDVHMPDMD GYKLLEHVGL  180
EMDLPVIMMS GDSTTSAVMK GIRHGACDYL IKPVREEELR NIWQHVVRKI WNENKEHDNS  240
GSMEDSDWNK RGNDDTEYTS SVADAAEVVK APKKRSSLKE EDIELESDDP ATSKKPRVVW  300
SVELHQQFVS AVNQLGLDKA VPKRILELMN VPGLTRENVA SHLQGWLTRL PVVDEKFRLY  360
LKRLSGVAQQ QNGMLNAVPG TIESNLSATG RFDIQALAAA GHVPPETLAA LHAELLGRPA  420
TNILSTADQA TLLQASIGLK HSHAEHAVAY GQPFVKCPSN IGKDFPPSFL TANDMSSGYG  480
AWPSSNNTMG SAVNGSASVN QNCSFGMNAV IDYSLLSQKS NNSVSASQFS GGDTKARAVL  540
YAHTMPSTCS MSSINGSIQQ LQNSTLTFGG ARPLPSPLPM SDRQDPYGLK SGDSFDQVCL  600
RNIGFIGKGT CIPNRFVQNE IESSVSDFSQ MKVNVDSTGN ALKEEPNFIN MQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-20294365464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521190.10.0PREDICTED: two-component response regulator ORR21-like
SwissprotQ8H7S71e-124ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLA0A0L9UU340.0A0A0L9UU34_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T1W20.0A0A0S3T1W2_PHAAN; Uncharacterized protein
STRINGGLYMA02G09451.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118082433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-95response regulator 2